Pay in 4 interest-free payments of $42.82 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
scleraxis homolog A
ADAR Polyclonal Antibody
JAML induces downstream cell signaling events in gamma-delta T-cells through PI3-kinase and MAP kinases
QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
CC2D1A Polyclonal Antibody-BS71565 Bioproduction scleraxis homolog ACC2D1A Polyclonal Antibody Sizes: 50l, 100l Catalogue Numbers: BS71565 50, BS71565 100 Product: 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: Q6P1N0 Host: Rabbit Reactivity: Human, Mouse, Rat Applications: WB, IHC All Applications: WB,1: 1000 1: 2000 IHC,1: 50 1: 200 Background: This gene encodes a transcriptional repressor that binds to a conserved 14 bp 5' repressor element and regulates expression of the 5
US$ 21.99
US$ 21.99
US$ 21.99
US$ 52.95